PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009598687.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 540aa    MW: 62221 Da    PI: 6.1311
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009598687.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM178.32e-5541311128
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeelv +yLk+k++g+k+el e+i+evd+yk+ePwdLp k  + +++ ewyfFs+ ++ky++g+r+nratk+gyWkatgkd++v 
  XP_009598687.1   4 LPPGFRFHPTDEELVAYYLKRKINGRKIEL-EIIPEVDLYKCEPWDLPgKsLLPSKDLEWYFFSPCNRKYPNGSRTNRATKAGYWKATGKDRKVN 97 
                     79****************************.99***************6434555777************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrl 128
                     s + ++vg+kktLv+y+grap+g +t+Wvmheyrl
  XP_009598687.1  98 S-QMRAVGMKKTLVYYRGRAPHGARTHWVMHEYRL 131
                     *.9999***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.97E-622154IPR003441NAC domain
PROSITE profilePS5100560.2694154IPR003441NAC domain
PfamPF023652.2E-295131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 540 aa     Download sequence    Send to blast
MVSLPPGFRF HPTDEELVAY YLKRKINGRK IELEIIPEVD LYKCEPWDLP GKSLLPSKDL  60
EWYFFSPCNR KYPNGSRTNR ATKAGYWKAT GKDRKVNSQM RAVGMKKTLV YYRGRAPHGA  120
RTHWVMHEYR LDERECEVAN GLQDGYALCR IFKKSLNAPK VVDLYYDDNM ESSDYRRPTQ  180
GSPFHVAAAG PSDDNKWSQC LSSDEAFSFN STTPSIPNYG TLTYAPPKVN IALPPLEVHD  240
FPQAGYVNYS TILPQSSYNI NQNTNQTDIV QQILSVTQAS QDHVNEDSFG GNYTQVADDF  300
SFLPHNDNQI HDLGSFNFDE DFKSDRIVEN LRWIGMSDMD LEKAFLEDYK TVPIDNVSGV  360
LKEEYELEGD TSGHNSSFNE FIKKTEDFSS EFGNDFEVYE KIEVNHRMFI ATQQAAKTFY  420
HQVVPSTTVT VHRNLVKSDL VKIPQNTPFF DCFLRKKLLI TRPWLGAVST LVGVIALLHA  480
FWIYFSLCLE NEGSIEENME RNEKKKKGQD CQWSCKEKKW PYFTLVLAFS TIWLHFLNSY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A4e-54216015171NO APICAL MERISTEM PROTEIN
1ut4_B4e-54216015171NO APICAL MERISTEM PROTEIN
1ut7_A4e-54216015171NO APICAL MERISTEM PROTEIN
1ut7_B4e-54216015171NO APICAL MERISTEM PROTEIN
3swm_A4e-54216018174NAC domain-containing protein 19
3swm_B4e-54216018174NAC domain-containing protein 19
3swm_C4e-54216018174NAC domain-containing protein 19
3swm_D4e-54216018174NAC domain-containing protein 19
3swp_A4e-54216018174NAC domain-containing protein 19
3swp_B4e-54216018174NAC domain-containing protein 19
3swp_C4e-54216018174NAC domain-containing protein 19
3swp_D4e-54216018174NAC domain-containing protein 19
4dul_A4e-54216015171NAC domain-containing protein 19
4dul_B4e-54216015171NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754412e-36HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009598687.10.0PREDICTED: uncharacterized protein LOC104094455 isoform X1
TrEMBLA0A068U2960.0A0A068U296_COFCA; Uncharacterized protein
STRINGPGSC0003DMT4000553220.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14952348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-133NAC domain containing protein 28